PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000283092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 314aa    MW: 35809.3 Da    PI: 5.6138
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000283092genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.49.2e-43181442128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                    p+GfrFhPt eelv++yLk k ++k++++ ++i+e+d+++++PwdL +++ +++  wyfFs++d ky +++r+nr+t  g Wk tgk++++  + +
  MDP0000283092  18 PVGFRFHPTPEELVDHYLKLKKQDKDFKC-DHIAEFDVCNFDPWDLAARIXSDDMVWYFFSPKDYKYINSTRSNRTTPGGHWKITGKERAIXXRxS 112
                    89***************************.89***************99999999*************************************9977 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++g k+tL+fy+   pk+ ktdWvmhe+ l
  MDP0000283092 113 KAVIGKKRTLTFYRRCXPKPIKTDWVMHEFYL 144
                    778**************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-4915165IPR003441NAC domain
PROSITE profilePS5100545.16317168IPR003441NAC domain
PfamPF023651.5E-2218143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGTLGSNRKT RGGGASDPVG FRFHPTPEEL VDHYLKLKKQ DKDFKCDHIA EFDVCNFDPW  60
DLAARIXSDD MVWYFFSPKD YKYINSTRSN RTTPGGHWKI TGKERAIXXR XSKAVIGKKR  120
TLTFYRRCXP KPIKTDWVMH EFYLIDSEAI SNPKLHQKDF VLCCMKKNXD MEDTSIGEVE  180
LGSYSVSNAE DHAAAVVTPE VRMRTVSSLK FFVMDVDSLK LNASLVHALQ SQDYXSSTYL  240
SXGYIELGDI PQGNAXIDDC NAMQSPFGYN NYSYPDKNDX STCDEGEPPS FTMXDFENEV  300
PDHMSQEVRI NILX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-331816816170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340840.11e-139PREDICTED: putative NAC domain-containing protein 94
TrEMBLM5XFX43e-75M5XFX4_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g02270.t011e-41(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14450518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.13e-40NAC domain containing protein 57